DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and LOC108179232

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_021322084.1 Gene:LOC108179232 / 108179232 -ID:- Length:185 Species:Danio rerio


Alignment Length:259 Identity:49/259 - (18%)
Similarity:74/259 - (28%) Gaps:106/259 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FESTPGITCSGSKPYYSKSKGSC-QASADTYCDTSKICKGSGTGYIGDTINCANWYYCDADALLG 122
            |...||   :.|....|||..|| ...|..||::|.:.:.||        |||..:||...|   
Zfish    15 FPCPPG---TWSNALGSKSVSSCWLCPAGFYCNSSGLIQPSG--------NCAPGFYCAGGA--- 65

  Fly   123 KGTCNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDA----NCHKYYTCSSKSLVEN 183
                                                 .|...||.    .|...|.|........
Zfish    66 -------------------------------------KTAMPDDGLTGNRCPTRYYCPQGCASPL 93

  Fly   184 TCENGLYYNVATGTCVRKKDVICENHPLPDEVCGNKKLAVRNKFVSDMATCRGYYYCRDLGSGIP 248
            .|.:|.:.| :||:..      |.:       |....|.:..:   |:..|...:||  :|..:.
Zfish    94 HCPDGTHSN-STGSAE------CSD-------CPTGWLCLEGE---DLQLCPKGHYC--VGGTVE 139

  Fly   249 DTDPIYQQCDENNFFNQERQACMPRESQKCDYDRCDGRKDGFEVAEIDGCHHYIECVDGRETTP 312
            |..|    |....:        .|:..|                ::::.|   :.|..|..:.|
Zfish   140 DILP----CPPGTY--------SPKAGQ----------------SQVEQC---LLCSAGESSAP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 8/50 (16%)
CBM_14 154..204 CDD:279884 11/53 (21%)
LOC108179232XP_021322084.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.