DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5883 and si:ch211-286b4.4

DIOPT Version :9

Sequence 1:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster
Sequence 2:XP_021322239.1 Gene:si:ch211-286b4.4 / 100005359 ZFINID:ZDB-GENE-131127-605 Length:2996 Species:Danio rerio


Alignment Length:344 Identity:72/344 - (20%)
Similarity:111/344 - (32%) Gaps:107/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GSCSESIICQNFES-------------TPGITC----SGSKPYYSKSKGSCQASADTYCDTSKIC 95
            |:||...:|....|             |||..|    |..:|....:.||.:.:|..     ::|
Zfish   128 GNCSPGYVCTQGASLSEPVGDSTGGRCTPGFFCPAGASHMEPCPLGTFGSLEGAASV-----EMC 187

  Fly    96 KGSGTGYIGDTINCANWYYCDADALLG-KGTCNLGMYFDQVSKSCVYSEDTVCAAKYE--ICDVA 157
            :           :|...:||....|.. .|.|:.|.|       ||....|.....|.  :|: .
Zfish   188 Q-----------SCTPGHYCAESGLTSPSGPCSPGYY-------CVQGSHTPAPQYYNNTVCE-E 233

  Fly   158 PVGTPFRDDANCHKYYTCSSKSLVENTCENGLYYNVATGTCVRKKDVICENHPLPDEVCGNKKLA 222
            |||....|        ..|....:.:.|..|.|..:.:   ||.:       |.|......::.|
Zfish   234 PVGHSAED--------IYSHLQFIGDICPAGHYCPIGS---VRPE-------PCPPGFFQGQRGA 280

  Fly   223 VRNKFVSDMATCRGYYYCRDLGS---------------GIPDTDPIYQQCDENN---FFNQERQA 269
            |..   :|...|...|||.|.|.               |.|......:||...:   :.:.|...
Zfish   281 VSE---TDCQPCTSGYYCPDWGQSSAELLCPEGSFCPPGSPTGHQPERQCPSGHACPYGSVEPAI 342

  Fly   270 CMPRESQKC-DYDRCDGRKDGFEVAEIDGCHHYIECVDG-----------RETTPISCEDKYFDV 322
            |:|...|.. ....|.....||..  ::||...:.|..|           |:.:|  |...::  
Zfish   343 CLPGTYQPLPSQPSCQPCPSGFYC--LEGCTSPLPCPAGTASVIEGLQSQRDCSP--CPPGFY-- 401

  Fly   323 VTQNCSSTHLV--YGACSS 339
                |:::.|:  .|.||:
Zfish   402 ----CNTSALISPSGPCSA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5883NP_648526.2 CBM_14 95..146 CDD:279884 11/51 (22%)
CBM_14 154..204 CDD:279884 11/49 (22%)
si:ch211-286b4.4XP_021322239.1 Ephrin_rec_like <945..983 CDD:311571
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.