DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and RPT5

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_014760.3 Gene:RPT5 / 854284 SGDID:S000005643 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:414 Identity:159/414 - (38%)
Similarity:242/414 - (58%) Gaps:35/414 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTDDERVRALTNY-------RTKLLEH--REIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQ 64
            |.|||..:.:.|.       |.|||::  |...|:|:.|..:..|:..:.:.:::.:|..:.:..
Yeast    13 PGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQRLSHENNVMLEKIKDNKEKIKNNRQLPY 77

  Fly    65 MVGEILK--------------------QLTPDN------FIVKASNGPRYVVGCRRQINKEKLKP 103
            :|..:::                    .:..||      .:||.|:.....:.....::.:||||
Yeast    78 LVANVVEVMDMNEIEDKENSESTTQGGNVNLDNTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKP 142

  Fly   104 GTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIF 168
            ...|.::..:..|:..||.|.|..|..|..::.....|:::|||.:||.||.|.|.||:...|.|
Yeast   143 NDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKF 207

  Fly   169 LRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARD 233
            ..:||..|||.|:||||||||||||||.|:|.:|.|||:.:..:|..||||.|:|:|:.||.|::
Yeast   208 KDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKE 272

  Fly   234 HQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPAL 298
            ..|.|||:||:||||.:||....|.|||:|||::|||||:|||.:..:||::.||||.|.|||||
Yeast   273 KAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPAL 337

  Fly   299 LRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFA 363
            ||.||||||:|.|||:|.:|..||:||:..:....:|:::.:.:.:|.||||.|:.:..|||:.|
Yeast   338 LRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIA 402

  Fly   364 LRCDREFVIQEDFMKAVRKIADNK 387
            ||..:..|..|||::.:.::...|
Yeast   403 LRNGQSSVKHEDFVEGISEVQARK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 156/410 (38%)
AAA 180..312 CDD:278434 80/131 (61%)
RPT5NP_014760.3 RPT1 5..434 CDD:224143 159/414 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.