DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and AT1G53780

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001185217.1 Gene:AT1G53780 / 841815 AraportID:AT1G53780 Length:620 Species:Arabidopsis thaliana


Alignment Length:372 Identity:163/372 - (43%)
Similarity:239/372 - (64%) Gaps:19/372 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 REIESKLKALRDKYKVVNAEYEKSEDDLKA-----LQSVGQMVGE-----------ILKQLTPD- 76
            :::|.::..|.:  |:.|...::|:..|..     |.|..||:.|           |:...|.| 
plant   233 KKVEKEINELAE--KICNLGIKESDTGLAPPNQWDLVSDKQMMQEEQPLLVATCTQIISPNTEDA 295

  Fly    77 NFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVNY 141
            .::|......:||||...:.:...::.|.||.:|.....|...||.::||.|..||.|:..:..|
plant   296 KYVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPKIDPSVTMMTVEEKPDATY 360

  Fly   142 AEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFLK 206
            ::|||..:||.::|||:|||:|:|:.|:|:||.||||.|.|||||:||||:|||:|::..|.|::
plant   361 SDIGGCKEQIEKIREVVELPMLHPEKFVRLGIDPPKGVLCYGPPGSGKTLVARAVANRTGACFIR 425

  Fly   207 VVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLN 271
            ||.|.:|.|||||.||::||:|..||..:.||:|.||||||||.||.:|..:|.|:|||::|:|.
plant   426 VVGSELVQKYIGEGARMVRELFQMARSKKACILFFDEIDAIGGARFDDGVGSDNEVQRTMLEILY 490

  Fly   272 QMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEID 336
            |:|||||.|.:|::|||||||.||||||||||||||:|..||:...|..|.|||...::...:|.
plant   491 QLDGFDARGNIKVLMATNRPDILDPALLRPGRLDRKVEFCLPDLEGRTQIFKIHTRTMSCERDIR 555

  Fly   337 YEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKI 383
            :|.:..|.....|||:|::|.|||::|:...|:.|.::||:.||.|:
plant   556 FELLAGLCPNSTGADIRSVCIEAGMYAIGARRKSVTEKDFLDAVNKV 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 163/372 (44%)
AAA 180..312 CDD:278434 83/131 (63%)
AT1G53780NP_001185217.1 cyclophilin <4..95 CDD:294131
RPT1 228..616 CDD:224143 163/372 (44%)
AAA 398..531 CDD:278434 83/132 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.