DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and AT5G20000

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_197500.1 Gene:AT5G20000 / 832122 AraportID:AT5G20000 Length:419 Species:Arabidopsis thaliana


Alignment Length:389 Identity:179/389 - (46%)
Similarity:250/389 - (64%) Gaps:18/389 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ERVRALTNYRTKLLE--HREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTP 75
            :|::...:|....||  ..|:.|:::.||              ::|:.||..|..|||::|.:..
plant    44 QRLQREKSYNLNRLEAQRNELNSRVRMLR--------------EELQLLQEPGSYVGEVVKVMGK 94

  Fly    76 DNFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVN 140
            :..:||.....:|||...:.|:..||.|.|||||...:..:...||.:|||||..|..|...:..
plant    95 NKVLVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDST 159

  Fly   141 YAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFL 205
            |..||||.|||:|::||||||:.:|::|..:||:.|||.||||||||||||||||:|...|..|:
plant   160 YDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFI 224

  Fly   206 KVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGT-SADREIQRTLMEL 269
            :|..|.:|.|||||.:|::||:|..||:|.|.||||||||:||..|...|: :.|.|:|||::||
plant   225 RVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLEL 289

  Fly   270 LNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGE 334
            |||:|||:|..::|::|||||.|.||.|||||||:|||:|.|.|||.:|.||||||:..:|....
plant   290 LNQLDGFEASNKIKVLMATNRIDILDQALLRPGRIDRKIEFPNPNEESRFDILKIHSRKMNLMRG 354

  Fly   335 IDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398
            ||.:.:.:..:..:||:|:.:|||||:||||..|..|.||||..||.|:. .|..|..:..:.:
plant   355 IDLKKIAEKMNGASGAELKAVCTEAGMFALRERRVHVTQEDFEMAVAKVM-KKDTEKNMSLRKL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 179/385 (46%)
AAA 180..312 CDD:278434 81/132 (61%)
AT5G20000NP_197500.1 RPT1 34..417 CDD:224143 179/387 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.