DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and RPT5A

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_187204.1 Gene:RPT5A / 819718 AraportID:AT3G05530 Length:424 Species:Arabidopsis thaliana


Alignment Length:416 Identity:163/416 - (39%)
Similarity:251/416 - (60%) Gaps:35/416 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LANPPTDD-ERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGE 68
            ||:..|:| .|...|.:...::|:.....:.|:.  |.||   .:.:::::.:|..:.:..:||.
plant    17 LASMSTEDITRATRLLDNEIRILKEDAQRTNLEC--DSYK---EKIKENQEKIKLNKQLPYLVGN 76

  Fly    69 ILK--QLTPDN-------------------FIVKASNGPRY---VVGCRRQINKEKLKPGTRVAL 109
            |::  ::.|::                   .::|.|.....   |||.   ::.:.||||..|.:
plant    77 IVEILEMNPEDDAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPVVGL---VDPDSLKPGDLVGV 138

  Fly   110 DVTTLTIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGIS 174
            :..:..|:..||.|.|..|..|..::....:|.:||||.:||:||.|.|.||:.:.:.|.::|:.
plant   139 NKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVR 203

  Fly   175 PPKGCLLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCII 239
            ||||.||||||||||||:|||.|:|.:|.|||:....:|..:||:.|:|:|:.|..|::..||||
plant   204 PPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCII 268

  Fly   240 FMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRL 304
            |:|||||||.:||....|.|||:|||::|||||:|||.:..::|:|.||||.|.|||||:|.|||
plant   269 FIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRL 333

  Fly   305 DRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDRE 369
            |||:|.|.|.|.||..||:||:..:|...::::|.:.:.:|.||||.|:.:|.|||:.|||.|..
plant   334 DRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDAT 398

  Fly   370 FVIQEDFMKAVRKIADNKKLESRLDY 395
            .|..|||.:.:.::...||  :.|:|
plant   399 EVNHEDFNEGIIQVQAKKK--ASLNY 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 159/407 (39%)
AAA 180..312 CDD:278434 78/131 (60%)
RPT5ANP_187204.1 RPT1 29..417 CDD:224143 154/395 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.