DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and RPT2b

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_179604.1 Gene:RPT2b / 816533 AraportID:AT2G20140 Length:443 Species:Arabidopsis thaliana


Alignment Length:392 Identity:174/392 - (44%)
Similarity:249/392 - (63%) Gaps:17/392 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLANPPTDDE-RVRALTNYRTKLLEHREI---ESKLKALRDKYKVVNAEYEKSE-DDLKAL-QSV 62
            |...|.|..: |:..|...:..||...|.   :.:||...:|     ||.::|: |||:.. .||
plant    53 PTVTPSTKCKLRLLKLERIKDYLLMEEEFVANQERLKPQEEK-----AEEDRSKVDDLRGTPMSV 112

  Fly    63 GQMVGEILKQLTPDNF-IVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDP 126
            |.     |::|..:|. ||.:|.||.|.||....::|::|:||..:.:....|:::..|..||||
plant   113 GN-----LEELIDENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDP 172

  Fly   127 LVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTL 191
            :|..|..|.....:||:||||..||:|::|.:||||.:|:::..:||.||||.:|||.|||||||
plant   173 MVSVMKVEKAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTL 237

  Fly   192 LARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGT 256
            ||:|:|:...|.||:||.|.::.||:|:..:|:||:|..|.|..|.|:|:|||||:|.:|:...:
plant   238 LAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDANS 302

  Fly   257 SADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDI 321
            ..:||||||::|||||:||||:.|.||:|:||||.::||||||||||:|||:|.|||:...|..|
plant   303 GGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPDIKTRRRI 367

  Fly   322 LKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADN 386
            .:||...:....:::.|..|...|.|:|||::.|||||||.|||..|..|...||.||..|:...
plant   368 FQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHVDFKKAKEKVMFK 432

  Fly   387 KK 388
            ||
plant   433 KK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 171/383 (45%)
AAA 180..312 CDD:278434 76/131 (58%)
RPT2bNP_179604.1 PTZ00361 7..443 CDD:185575 174/392 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D571919at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.