DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and PSMC5

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_024306608.1 Gene:PSMC5 / 5705 HGNCID:9552 Length:433 Species:Homo sapiens


Alignment Length:413 Identity:178/413 - (43%)
Similarity:253/413 - (61%) Gaps:37/413 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTPDN 77
            |.::.:.|.:::.|.      :|:|.|::   :||:.....::|:.||..|..|||:::.:....
Human    29 EELQLIVNDKSQNLR------RLQAQRNE---LNAKVRLLREELQLLQEQGSYVGEVVRAMDKKK 84

  Fly    78 FIVKASNGPRYVVGCRRQINKE---------------------KLKPGT------RVALDVTTLT 115
            .:||.....::||...:.|:..                     ||.|.|      ||||...:.|
Human    85 VLVKVHPEGKFVVDVDKNIDINDVSVAGEVVVVVGSALTVPLLKLAPFTQVTPNCRVALRNDSYT 149

  Fly   116 IMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCL 180
            :.:.||.:|||||..|..|...:..|..||||.:||:|::||||||:.:|::|..:||:.|||.|
Human   150 LHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVL 214

  Fly   181 LYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEID 245
            |||||||||||||||:|...|..|::|..|.:|.|:|||.||::||:|..||:|.|.||||||||
Human   215 LYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEID 279

  Fly   246 AIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEI 310
            :||..|...|:..|.|:|||::|||||:|||:|...:|:||||||.|.||.|||||||:|||:|.
Human   280 SIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEF 344

  Fly   311 PLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQED 375
            |.|||.||:||||||:..:|....|:...:.:|....:||:::.:|||||::|||..|..|.|||
Human   345 PPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQED 409

  Fly   376 FMKAVRKIADNKKLESRLDYKPI 398
            |..||.|:. .|..|..:..|.:
Human   410 FEMAVAKVM-QKDSEKNMSIKKL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 177/409 (43%)
AAA 180..312 CDD:278434 82/131 (63%)
PSMC5XP_024306608.1 RPT1 4..431 CDD:224143 178/411 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.