DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and PSMC2

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_002794.1 Gene:PSMC2 / 5701 HGNCID:9548 Length:433 Species:Homo sapiens


Alignment Length:399 Identity:167/399 - (41%)
Similarity:246/399 - (61%) Gaps:26/399 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DDERVRALTNYRTKLL----------EHREIESKLKALRDKYKVVNAEYEKSED----------- 54
            ||:.:|||......||          :.:::|..::.|..|...:....|....           
Human    18 DDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA 82

  Fly    55 DLKALQSVGQM-VGEILKQLTPDN----FIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTL 114
            |.:.|||...: |....|.:..|:    :|:......::||....|:....::.|.||.:|....
Human    83 DKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKY 147

  Fly   115 TIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGC 179
            .|...||.::||.|..|..|:..:|.|:::||..:||.:||||:|.|||:|:.|:.:||.||||.
Human   148 QIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGV 212

  Fly   180 LLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEI 244
            ||:|||||||||.|||:|::.||.|::|:.|.:|.||:||.||::||:|..||..:.|:||.|||
Human   213 LLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEI 277

  Fly   245 DAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLE 309
            |||||.||.:|...|.|:|||::||:||:||||..|.:|::|||||||||||||:||||||||:|
Human   278 DAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIE 342

  Fly   310 IPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQE 374
            ..||:...|..|.||||..::...:|.:|.:.:|.....||::|::|||||:||:|..|:...::
Human   343 FSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEK 407

  Fly   375 DFMKAVRKI 383
            ||::||.|:
Human   408 DFLEAVNKV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 165/397 (42%)
AAA 180..312 CDD:278434 83/131 (63%)
PSMC2NP_002794.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 2/3 (67%)
RPT1 23..430 CDD:224143 165/394 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.