DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and Rpt6R

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster


Alignment Length:381 Identity:172/381 - (45%)
Similarity:246/381 - (64%) Gaps:20/381 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TDDERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLT 74
            |.:||.:.|...:.   :..|:..|::.||              ::|:.||..|..:.|::|.:.
  Fly    28 TVNERQKNLLRLQA---QRNELNLKVRLLR--------------EELQLLQEQGSYIAEVVKPMD 75

  Fly    75 PDNFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNV 139
            .:..:||.....:|||...:.||.:.:.|.:||||...:.|:.:.||.:|||||..|..|...:.
  Fly    76 KNKVLVKVHPEGKYVVDVDKTINIKDVTPSSRVALRNESYTLHKILPNKVDPLVSLMLVEKVPDS 140

  Fly   140 NYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANF 204
            .|..:|||.:||:|::||||||:.:|::|..:||:.|||.||||||||||||||||:|...:..|
  Fly   141 TYEMVGGLDKQIQEIKEVIELPVKHPELFDALGITQPKGVLLYGPPGTGKTLLARAVAHHTECTF 205

  Fly   205 LKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMEL 269
            ::|..|.:|.|:|||.:|::||:|..||:|.|.||||||||:||..|...|| .|.|:|||::||
  Fly   206 IRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGT-GDSEVQRTMLEL 269

  Fly   270 LNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGE 334
            |||:|||:|...:|:||||||.|.||.|||||||:|||:|.|.|||.||:||||||:..:|....
  Fly   270 LNQLDGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRG 334

  Fly   335 IDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKI--ADNKK 388
            |:...:.:.....:||:::.:|||||::|||..|..|.||||..||.|:  .|::|
  Fly   335 INLRKIAEEMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 171/378 (45%)
AAA 180..312 CDD:278434 81/131 (62%)
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 172/381 (45%)
AAA 180..311 CDD:278434 81/131 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.