DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and Rpt6

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:369 Identity:171/369 - (46%)
Similarity:242/369 - (65%) Gaps:1/369 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTPDNFIVKASNGPRYVVGCRR 94
            |....|:.|:.:...:||:.....::|:.||..|..|||::|.:.....:||.....::||...:
  Fly    36 EKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDK 100

  Fly    95 QINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIE 159
            .|:...:.|..||||...:.|:.:.||.:|||||..|..|...:..|..:|||.:||:|::||||
  Fly   101 NIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIE 165

  Fly   160 LPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLI 224
            ||:.:|::|..:||:.|||.||||||||||||||||:|...:..|::|..|.:|.|:|||.:|::
  Fly   166 LPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMV 230

  Fly   225 REMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATN 289
            ||:|..||:|.|.||||||||:||..|...|:..|.|:|||::|||||:|||:|...:|:|||||
  Fly   231 RELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATN 295

  Fly   290 RPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRN 354
            |.|.||||||||||:|||:|.|.|||.||:||||||:..:|....|:...:.:|....:||:::.
  Fly   296 RIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG 360

  Fly   355 ICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398
            :|||||::|||..|..|.||||..||.|:. .|..|..:..|.:
  Fly   361 VCTEAGMYALRERRVHVTQEDFEMAVAKVM-QKDSEKNMSIKKL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 170/365 (47%)
AAA 180..312 CDD:278434 81/131 (62%)
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 171/367 (47%)
SlyX <27..>69 CDD:294687 8/32 (25%)
AAA_16 152..>205 CDD:289934 35/52 (67%)
AAA 185..317 CDD:278434 81/131 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.