DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and Psmc3

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_113783.2 Gene:Psmc3 / 29677 RGDID:61905 Length:442 Species:Rattus norvegicus


Alignment Length:403 Identity:164/403 - (40%)
Similarity:240/403 - (59%) Gaps:38/403 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RTKLLEHR---------EIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTPD- 76
            ||:||:..         .:..:|:|::||.|      |.|| .:|..:::..:|..:::.|..| 
  Rat    47 RTRLLDSEIKIMKSEVLRVTHELQAMKDKIK------ENSE-KIKVNKTLPYLVSNVIELLDVDP 104

  Fly    77 --------NF-----------IVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPR 122
                    |.           ::|.|....|.:.....::.||||||..|.::..:..|:..||.
  Rat   105 NDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPT 169

  Fly   123 EVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGT 187
            |.|..|..|..::.....|::||||.:||:||.|.|.||:.:.:.|..:||.||||.|:||||||
  Rat   170 EYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGT 234

  Fly   188 GKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRF 252
            ||||||||.|:|..|.|||:....:|..:||:.|:|:|:.||.|::..|.|||:||:||||.:||
  Rat   235 GKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRF 299

  Fly   253 SEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVA 317
            ....:.|||:|||::|||||:|||....|||:|.||||.|.|||||||.||||||:|.|:|||.|
  Rat   300 DSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEA 364

  Fly   318 RMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRK 382
            |..|::||:..:|...:::||.:.:.:|.||||..:.:|.|||:.|||.....:..||:|:.:.:
  Rat   365 RARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILE 429

  Fly   383 IADNKKLESRLDY 395
            :...||  :.|.|
  Rat   430 VQAKKK--ANLQY 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 164/403 (41%)
AAA 180..312 CDD:278434 79/131 (60%)
Psmc3NP_113783.2 RPT1 28..435 CDD:224143 160/394 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.