DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and Psmc1

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_032973.1 Gene:Psmc1 / 19179 MGIID:106054 Length:440 Species:Mus musculus


Alignment Length:393 Identity:173/393 - (44%)
Similarity:247/393 - (62%) Gaps:19/393 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PLANPPTDDERVRALTNYRTK---LLEHREI--ESKLKALRDKYKVVNAEYEKSE-DDLKAL-QS 61
            ||..|.|.. |::.|...|.|   |:|...|  :.::|.|.:|     .|.|:|: |||:.. .|
Mouse    50 PLVTPHTQC-RLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEK-----QEEERSKVDDLRGTPMS 108

  Fly    62 VGQMVGEILKQLTPDNF-IVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVD 125
            ||     .|:::..||. ||..|.|..:.|.....::|:.|:||..|.|:.....::..|..:.|
Mouse   109 VG-----TLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTD 168

  Fly   126 PLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKT 190
            |||..|..|......||:||||..||:|::|.:||||.:|:.:..:||.||||.:||||||||||
Mouse   169 PLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKT 233

  Fly   191 LLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEG 255
            |||:|:|:|..|.||:||.|.::.||:|:..:|:||:|..|.:|.|.|:|:|||||||.:|:...
Mouse   234 LLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSN 298

  Fly   256 TSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMD 320
            :..:||||||::|||||:||||:.|.||:||||||.:||||||:||||:|||:|.|||:|..:..
Mouse   299 SGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKR 363

  Fly   321 ILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIAD 385
            |.:||...:....::..:.::...|..:|||::.|||||||.|||..|..|..|||.|:...:..
Mouse   364 IFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLY 428

  Fly   386 NKK 388
            .|:
Mouse   429 KKQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 169/384 (44%)
AAA 180..312 CDD:278434 80/131 (61%)
Psmc1NP_032973.1 PTZ00361 1..440 CDD:185575 173/393 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.