DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpt4R and Psmc4

DIOPT Version :9

Sequence 1:NP_001287039.1 Gene:Rpt4R / 39351 FlyBaseID:FBgn0036224 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_476463.1 Gene:Psmc4 / 117262 RGDID:621102 Length:418 Species:Rattus norvegicus


Alignment Length:392 Identity:162/392 - (41%)
Similarity:245/392 - (62%) Gaps:3/392 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LANPPTDDERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEI 69
            |...|.|.|.:.:......:.||..|::.:.  ::|:.|.:..|:..:::::|.:||:..::|:.
  Rat    30 LGPEPEDLEDLYSRYKKLQQELEFLEVQEEY--IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQF 92

  Fly    70 LKQLTPDNFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHE 134
            |:.:..:..||.::.|..|.|.....|::|.|||...|||...:..::..||.|.|..:..:|.:
  Rat    93 LEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSD 157

  Fly   135 DPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQ 199
            ...:|.||:|||:..|.:|:||.:||||.:.:::.::||.||:|.|:|||||.|||:||:|:|..
  Rat   158 QKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHH 222

  Fly   200 MDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQR 264
            ..|.|::||.|..|.||:||..|::|::|..|:::.|.|||:||||||..:||...|.||||:||
  Rat   223 TTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQR 287

  Fly   265 TLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPL 329
            .|:||||||||||....||:||||||.||||||||||||||||:|.|||:...:..|.......:
  Rat   288 ILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKM 352

  Fly   330 NKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLD 394
            |...|:|.|..|...|..:|||:.:||.|:|:.|:|.:|..|:.:||.||.:.:....:.|... 
  Rat   353 NLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEF- 416

  Fly   395 YK 396
            ||
  Rat   417 YK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpt4RNP_001287039.1 RPT1 13..396 CDD:224143 157/382 (41%)
AAA 180..312 CDD:278434 82/131 (63%)
Psmc4NP_476463.1 PTZ00454 34..418 CDD:240423 159/386 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D298123at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.