DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment byn and EOMES

DIOPT Version :9

Sequence 1:NP_524031.2 Gene:byn / 39349 FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens


Alignment Length:562 Identity:179/562 - (31%)
Similarity:246/562 - (43%) Gaps:136/562 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GNVSGGGGGGGAGGGAGSGSPQHVTHNGHGHGHGLGGVAAVSGGGASVSGNGGHRVVGGAGSPNE 82
            |..:|.|.||.:|||.|.|:.|: :.....:|...|..||.|.||           :||.|.|..
Human   211 GAGAGSGAGGSSGGGGGPGTYQY-SQGAPLYGPYPGAAAAGSCGG-----------LGGLGVPGS 263

  Fly    83 LDRNLRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRW 147
            ..| ..:.|.:|.|||:|.....|||:||.||||||.:..:.:||:|.|.|.|.:|.|..|.:.|
Human   264 GFR-AHVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEVVLADPNHW 327

  Fly   148 KYVNGEWVPGGKAE-VPPSNPIYVHPESPNFGAHWMKEPISFAKVKLTNK---TNGNGQ-IMLNS 207
            ::..|:||..|||: ....|.:||||||||.|:|||::.|||.|:||||.   .|.|.| |:|.|
Human   328 RFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNTQMIVLQS 392

  Fly   208 LHKYEPRVHLVRVG-------SEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDA 265
            ||||:||:|:|.|.       :|.....|:.|.||||||||||||.::|.|||.:|||||.|.|.
Human   393 LHKYQPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPFAKGFRDN 457

  Fly   266 KERPDTLYPHDTHYGWLIPPPTHYTAAAAAVAAPPPLSIAQSHGLVASCPSVSSAESVGPSSGGS 330
            .:                   :.|||:......|.|....:||.:|               .|| 
Human   458 YD-------------------SMYTASENDRLTPSPTDSPRSHQIV---------------PGG- 487

  Fly   331 CDRYGRSLSSRSVAP---TRTTP----YSRPRVVSGSGSNGSAGNASSTSPQPPSAPQ----TPT 384
              |||    .:|..|   ..|.|    |:..|.|  ..:||......|.....|  ||    ||.
Human   488 --RYG----VQSFFPEPFVNTLPQARYYNGERTV--PQTNGLLSPQQSEEVANP--PQRWLVTPV 542

  Fly   385 SLHSTSTGSVSTSVSSSSGG-----GIGSAPSTGCFSSSYAQSGFMSVDASPTASVFSYPSSWQS 444
            ....|:...:|:..|..:..     ||.|.|    ..:|:|    :.....||   |...:.|..
Human   543 QQPGTNKLDISSYESEYTSSTLLPYGIKSLP----LQTSHA----LGYYPDPT---FPAMAGWGG 596

  Fly   445 NGNY---------WNATSVPGPMPMNVCSGRNISS-------HNSPS----PTNGSPSYTTS--- 486
            .|:|         |.:.:.|.....:..|...:..       ...||    .:|.|..||::   
Human   597 RGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKR 661

  Fly   487 ---SPSYTIHHLTP-------HSHQYNMAQTDIYGTGVGVGG 518
               |||.:.:..:|       ::.:|:.      .|..|:||
Human   662 RRLSPSNSSNENSPSIKCEDINAEEYSK------DTSKGMGG 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 95/193 (49%)
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 95/211 (45%)
T-box_assoc 482..703 CDD:292794 54/259 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.