DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment byn and Tbx4

DIOPT Version :10

Sequence 1:NP_524031.2 Gene:byn / 39349 FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_035666.2 Gene:Tbx4 / 21387 MGIID:102556 Length:552 Species:Mus musculus


Alignment Length:120 Identity:28/120 - (23%)
Similarity:40/120 - (33%) Gaps:50/120 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVSDLPPS---SPKGSPDRHDPSTSSPSP----------------SRG--GDNQSEVISKSEEYR 73
            :|..|||.   |.|..|.:|    ...||                .||  .||     .|:.|:|
Mouse   530 LVHSLPPDPEWSVKSPPPKH----KDQSPLNIGLLLNLEHALSVLERGPPADN-----PKAAEFR 585

  Fly    74 QLFRLPADEILVQDFNCACQESILMQG------------------HMYLFIHYIC 110
            ||:...::....||  .|..|::|..|                  |::..|.:.|
Mouse   586 QLWGSRSELRRFQD--GAITEAVLWSGSSACDKRLVLLEIITHLLHLHADIPHSC 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 T-box_TBXT_TBX19-like 87..264 CDD:410318 8/42 (19%)
Tbx4NP_035666.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
T-box_TBX4_5-like 72..256 CDD:410315
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.