DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment byn and mls-1

DIOPT Version :9

Sequence 1:NP_524031.2 Gene:byn / 39349 FlyBaseID:FBgn0011723 Length:697 Species:Drosophila melanogaster
Sequence 2:NP_498640.1 Gene:mls-1 / 186741 WormBaseID:WBGene00003376 Length:252 Species:Caenorhabditis elegans


Alignment Length:184 Identity:88/184 - (47%)
Similarity:125/184 - (67%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LRISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVL--LEFVQIDSHRWKY 149
            :|:.|....||.||.||..||||||:||||||.:.:..:||||...|.|:  ||.:::...|:.:
 Worm    31 IRVFLQSSNLWRRFHNLGTEMIVTKSGRRMFPTLSVIIAGLDPVKSYVVMVDLECIEMKRFRYSF 95

  Fly   150 VNGEWVPGGKAEVPPSNPIYVHPESPNFGAHWMKEPISFAKVKLT-NKTNGNGQIMLNSLHKYEP 213
            ...:|:..|..|....:.::||.:||..|||||:.|:||.|:||| |:.:.||.|::||:|||.|
 Worm    96 HQSKWISTGPGESELPSRMFVHTDSPARGAHWMRAPVSFDKMKLTNNQLDNNGHIIVNSMHKYRP 160

  Fly   214 RVHLV-RVGSEQRHVVTYPFPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDAK 266
            |||:: :..|::||  |:.|.||:|||||||||..:|||||:.|||||.|.:.:
 Worm   161 RVHIIEQDDSQKRH--TFSFEETEFIAVTAYQNHRITSLKIESNPFAKGFRECE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bynNP_524031.2 TBOX 86..268 CDD:238106 88/184 (48%)
mls-1NP_498640.1 TBOX 31..212 CDD:238106 88/182 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.