DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and EPS1

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:28/115 - (24%)
Similarity:39/115 - (33%) Gaps:46/115 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PVNIDVCPRSSRKSESSYLMAEYGDGLITRIDEG-NWKEVLTGE---------WLLLICSSHQPS 78
            |.|:|. ...|.||||.||             || ::.|::.|:         |......:...|
Yeast   144 PNNLDT-DLDSAKSESQYL-------------EGFDFLELIAGKATRPHLVSFWPTKDMKNSDDS 194

  Fly    79 --------CGD----WKAVLYQLASTSMGCLDV----------DLAFGDL 106
                    |.:    ||.:..|||...:....|          :|.||||
Yeast   195 LEFKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTICEELGFGDL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 18/88 (20%)
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038
PTZ00102 <404..>472 CDD:240266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2346
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.