DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11588 and TXNDC5

DIOPT Version :9

Sequence 1:	NP_001261729.1	Gene:	CG11588 / 39347	FlyBaseID:	FBgn0036221	Length:	270	Species:	Drosophila melanogaster
Sequence 2:	NP_110437.2	Gene:	TXNDC5 / 81567	HGNCID:	21073	Length:	432	Species:	Homo sapiens

Alignment Length:	117	Identity:	27/117 - (23%)
Similarity:	41/117 - (35%)	Gaps:	23/117 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    37 SESSYLMA--EYGDGLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCLDV 99
            ||:..|.|  |...|.:..:.|.|:.:.: .|.:..| ..:.|.||..|.    ||.|
Human   308 SEAPVLAAEPEADKGTVLALTENNFDDTI-AEGITFI-KFYAPWCGHCKT----LAPT------- 359

  Fly   100 DLAFGDLSTNFWLRGRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLR 151
               :.:||     :..|.......:..|.....|.:.|.:.......|||.|
Human   360 ---WEELS-----KKEFPGLAGVKIAEVDCTAERNICSKYSVRGYPTLLLFR 403

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11588	NP_001261729.1	Thioredoxin_like	51..148	CDD:294274	17/96 (18%)
TXNDC5	NP_110437.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	40..63
		PDI_a_ERp46	61..164	CDD:239303
		ER_PDI_fam	66..432	CDD:273457	27/117 (23%)
		PDI_a_ERp46	190..290	CDD:239303
		PDI_a_ERp46	323..424	CDD:239303	21/102 (21%)
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	429..432
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910