DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Tmx1

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_082615.1 Gene:Tmx1 / 72736 MGIID:1919986 Length:278 Species:Mus musculus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:96/223 - (43%) Gaps:29/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IDEGNWKEVLTGEWLLLICSSHQPSC----GDWKAVLYQLASTSMG-CLDVDLAFGDLSTNFWLR 113
            :.:.||..:|.|||::...:...|:|    .:|::.      ...| .|:|.:|..|::....|.
Mouse    34 LTDENWTSLLEGEWMIEFYAPWCPACQNLQPEWESF------AEWGEDLEVKVAKVDVTEQTGLS 92

  Fly   114 GRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVLK 178
            |||......::||..||||||..........:|.:..:||..:.|:..|..|:|...|....:.:
Mouse    93 GRFIITALPSIYHCKDGEFRRYVGPRTKKDFINFVSDKEWKNIEPISSWFGPSSVLMTMMSALFQ 157

  Fly   179 TAVDLKD-----LDILGRNAWKTALILDLIFFIVTPYILWLTIMTTTENMMVNDEFKLGPTESSS 238
            .:|.::.     :..||..||.:.|:. ....:::..:|.|.::...:        .|.|::...
Mouse   158 LSVYIRTSHSYFVHDLGIPAWGSYLVF-AFATVLSGLLLGLCMIFVAD--------CLCPSKRRK 213

  Fly   239 PLPLKSISKIKSTTPIFLQKLRQLRESK 266
            |    .....|.|:|.|.|.|:::.|.:
Mouse   214 P----QQQYAKKTSPEFSQPLKKVEEEQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 27/98 (28%)
Tmx1NP_082615.1 PDI_a_TMX 30..129 CDD:239292 27/100 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..278 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2346
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.