DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Tmx3

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_038953303.1 Gene:Tmx3 / 682967 RGDID:1592777 Length:470 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:43/119 - (36%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KSESSYLMAEYGDG-LITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCLDV 99
            |.::.::..||.|| |.:.|....::..||.:..|                ||:|..|  |.| |
  Rat   221 KDDTYFVYDEYEDGDLSSWISRERFQNYLTMDGFL----------------LYELGDT--GKL-V 266

  Fly   100 DLAFGDLSTNFWLRGRFSAFREANVYHVVDGEFRRLSSSH-DTNSILNLLLLRE 152
            .:|..|.........|..:..:.......|...|.....| |.|..:|.||:.|
  Rat   267 AIAVIDEKNTSLEHTRLKSIIQEVARDFRDHFHRDFQFGHMDGNDYINTLLMDE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 20/97 (21%)
Tmx3XP_038953303.1 PDI_a_TMX3 44..147 CDD:239298
ER_PDI_fam 46..>361 CDD:273457 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.