DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and TMX4

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_066979.2 Gene:TMX4 / 56255 HGNCID:25237 Length:349 Species:Homo sapiens


Alignment Length:209 Identity:48/209 - (22%)
Similarity:73/209 - (34%) Gaps:60/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NWKEVLTGEWLLLICSSHQPSC----GDWKAVLY--QLASTSMGCLDVDLAFGDLSTNFWLRGRF 116
            ||..|:.|||:|...:...|||    .:|:|...  ::...|:|.:||....|       |.|||
Human    46 NWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPG-------LSGRF 103

  Fly   117 SAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTS-------------- 167
            ........:|..||.|||.........:.|.:|.::|..:.|:..|..|.|              
Human   104 FVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYILEKKWQSVEPLTGWKSPASLTMSGMAGLFSISG 168

  Fly   168 -TWSTSAEFVLKTAVDLKDLDILGRNAWKTALILDLIFFIVTPYI----LWLTIMTTTENMMVND 227
             .|.....|.:          .||..||     ...:||::...:    :.|.::..:|...|  
Human   169 KIWHLHNYFTV----------TLGIPAW-----CSYVFFVIATLVFGLFMGLVLVVISECFYV-- 216

  Fly   228 EFKLGPTESSSPLP 241
                       |||
Human   217 -----------PLP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 28/95 (29%)
TMX4NP_066979.2 PDI_a_TMX 37..137 CDD:239292 28/97 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.