DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and tmx3a

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001018393.2 Gene:tmx3a / 553578 ZFINID:ZDB-GENE-050522-396 Length:437 Species:Danio rerio


Alignment Length:208 Identity:44/208 - (21%)
Similarity:80/208 - (38%) Gaps:53/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LMAEYGDGLITRIDEGNWKEVLTGEWLL-------LICSSHQPSCGDWKAVLYQLAS-TSMGCLD 98
            |::.|.:||..:..|....|:    ||:       ..|.:.:|...:..|.|..|.| .::|.:|
Zfish    18 LVSGYVEGLDDKFTEFRQNEL----WLVEFYAPWCAYCHTFEPVWTEVGAELKSLGSPVNVGKID 78

  Fly    99 VDLAFGDLSTNFWLRG--RFSAFR-----EANVYHVVDG--------------------EFRRLS 136
            . .|...::|.|.:||  ....|:     :.......||                    .|:.:.
Zfish    79 T-TAHTSIATEFNIRGYPTIKLFKGDLSFDYKGPRTKDGIIEFTNRVSGPVVRPLSSVQLFQHVM 142

  Fly   137 SSHDTNSIL---NLLLLREWSELPPMPFWLHPTSTWSTSAEFVLKTAVDLKDLDILGRNAWKTAL 198
            |.||...:.   ..||.:|:.: ....|.:|  :.:.|::|.:|..||.|:|:..:       |:
Zfish   143 SRHDVIFVYIGGESLLKKEYYK-AATEFIVH--TYFFTASEEILPKAVTLQDVPAV-------AV 197

  Fly   199 ILDLIFFIVTPYI 211
            ..|..::|...:|
Zfish   198 FKDGTYYIYNEFI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 24/134 (18%)
tmx3aNP_001018393.2 PDI_a_TMX3 22..125 CDD:239298 23/107 (21%)
Thioredoxin_6 155..332 CDD:290560 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.