DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and tmx1

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016906.1 Gene:tmx1 / 549660 XenbaseID:XB-GENE-1015794 Length:263 Species:Xenopus tropicalis


Alignment Length:189 Identity:54/189 - (28%)
Similarity:84/189 - (44%) Gaps:19/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSYLMAEYGDGLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCLDVDLAF 103
            ||.::|:.||  :..|.:.||.|||.|||::...:...|:|...:....:||..... |:|::|.
 Frog    15 SSEVLAKKGD--VIDITDSNWNEVLEGEWMIKFYAPWCPACHKLQPEWNELADWGED-LNVNIAK 76

  Fly   104 GDLSTNFWLRGRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTST 168
            .|::....|.|||.......:||..||.||:...|......:|.:..|||..:.|:..|:.|.|.
 Frog    77 VDVTAQPGLSGRFIITALPTIYHCKDGVFRKYQGSRTHKDFINFISEREWEAIEPVSSWVGPDSF 141

  Fly   169 WST--SAEFVLKTAVD------LKDLD--------ILGRNAWKTALILDLIFFIVTPYI 211
            ..:  ||.|.|...:.      ::||.        |.|.......|:|.||...|..::
 Frog   142 LMSGMSALFQLSMWIRQCHNYFVEDLAIPVWGSYIIFGLMTLFLGLMLGLILVFVADFL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 29/96 (30%)
tmx1NP_001016906.1 PDI_a_TMX 23..123 CDD:239292 31/102 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.