DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Tmx4

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_083424.1 Gene:Tmx4 / 52837 MGIID:106558 Length:335 Species:Mus musculus


Alignment Length:242 Identity:53/242 - (21%)
Similarity:83/242 - (34%) Gaps:71/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSYLMAEYGDGL-----------ITRIDEGNWKEVLTGEWLLLICSSHQPSC----GDWK--AVL 86
            :::|.|...:||           :..:...||..|:.|||:|...:...|||    .:|:  |..
Mouse    12 AAWLAAAAAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWETFAKN 76

  Fly    87 YQLASTSMGCLDVDLAFGDLSTNFWLRGRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLR 151
            .:....|:|.:||....|       |.|||........:|..||.|||.........:.|.:|.:
Mouse    77 GETLQISVGKVDVIQEPG-------LSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYILEK 134

  Fly   152 EWSELPPMPFWLHPTS---------------TWSTSAEFVLKTAVDLKDLDILGRNAWKTALILD 201
            :|..:.|:..|..|.|               .|.....|.:          .||..||     ..
Mouse   135 KWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYFTV----------TLGIPAW-----CS 184

  Fly   202 LIFFIVTPYI----LWLTIMTTTENMMVNDEFKLGPTESSSPLPLKS 244
            .:||::...:    :.|.::..:|...|             |||..|
Mouse   185 YVFFVIATLVFGLFMGLILVVISECFCV-------------PLPRAS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 28/102 (27%)
Tmx4NP_083424.1 Thioredoxin_like 33..133 CDD:294274 28/106 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.