DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and p4hb

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_998529.3 Gene:p4hb / 406673 ZFINID:ZDB-GENE-080610-1 Length:509 Species:Danio rerio


Alignment Length:232 Identity:54/232 - (23%)
Similarity:88/232 - (37%) Gaps:63/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MAEYGDGLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCL-----DVDLA 102
            :||..|.|:  :.:.|::|.|.....:|: ..:.|.||..||:..:. |.:.|.|     |:.||
Zfish    18 IAEEEDVLV--LKKSNFEEALKAHPNVLV-EFYAPWCGHCKALAPEY-SKAAGMLKAEGSDIRLA 78

  Fly   103 FGD------LSTNFWLRG----------------RFSAFREA-------------------NVYH 126
            ..|      |:..|.:||                .:||.|:|                   :|..
Zfish    79 KVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQ 143

  Fly   127 ----VVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEF-VLKTAVDL-KD 185
                :.|.|...:....|..|..:...::....:..:||.:  ||..|..|:| |.|.:|.| |.
Zfish   144 AESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGI--TSDDSVFAKFEVAKDSVVLFKK 206

  Fly   186 LDILGRNAWKTAL----ILDLIFFIVTPYILWLTIMT 218
            .| .|||.:...:    :|:.|.....|.::..|..|
Zfish   207 FD-EGRNTFDGEVSKESLLNFIKANQLPLVIEFTEQT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 29/146 (20%)
p4hbNP_998529.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.