DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and p4hb

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001034820.1 Gene:p4hb / 395048 XenbaseID:XB-GENE-494070 Length:506 Species:Xenopus tropicalis


Alignment Length:312 Identity:64/312 - (20%)
Similarity:109/312 - (34%) Gaps:108/312 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLILLLSVFG----VIPNAMIPKSPVNIDVCPRSSRKSESSYLMAEYGDGLITRIDEGNWKEVLT 64
            |.:||   ||    ::..|.||                       |..|.|:.:.|  |:.|.|.
 Frog     3 RAVLL---FGCSLLIVARANIP-----------------------EERDVLVLKKD--NFDEALK 39

  Fly    65 GEWLLLICSSHQPSCGDWKAVL--YQLASTSMGCLDVDLAFG--------DLSTNFWLRG----- 114
             ::..::...:.|.||..||:.  |:.|:..:....:.:..|        ||:..|.:||     
 Frog    40 -QYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIK 103

  Fly   115 -----------RFSAFREANVYHVVDGEFRRLSSSHDT-NSILNLLLLREWSELPPMPFWLHPTS 167
                       .:||.|||  ..:|:...:|...:..| .....:..|.:.||:..:.|:..|. 
 Frog   104 FFKNGDKASPKEYSAGREA--ADIVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPA- 165

  Fly   168 TWSTSAEFVLKTAVDLKDLD--------------------IL------GRNAWKTALILDLIFFI 206
              |..|:..|:.|..:.|:.                    :|      ||||::..:..:.:...
 Frog   166 --SEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKDGIVLFKKFDEGRNAYEGDITKEEVLSF 228

  Fly   207 VTPYILWLTIMTTTENMMVNDEFKLGPTESSSPLPLKSISKIKSTTPIFLQK 258
            :....|.|.|           ||    ||.::|:...  .:||:....||.|
 Frog   229 IKANRLPLVI-----------EF----TEQTAPMIFG--GEIKTHILFFLPK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 25/123 (20%)
p4hbNP_001034820.1 ER_PDI_fam 25..474 CDD:273457 55/264 (21%)
pdi_dom 29..133 CDD:273454 23/108 (21%)
PDI_b_family 137..232 CDD:239279 16/97 (16%)
PDI_b'_family 244..347 CDD:239280 6/22 (27%)
PDI_a_PDI_a'_C 368..470 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.