DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and pdia3

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_989329.1 Gene:pdia3 / 394954 XenbaseID:XB-GENE-976328 Length:501 Species:Xenopus tropicalis


Alignment Length:87 Identity:18/87 - (20%)
Similarity:37/87 - (42%) Gaps:11/87 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KSESSYLMAEYGDGLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAV--LYQLASTSMG--- 95
            |||:   :.|..||.:..:...|:.|::..:...::...:.|.||..|.:  .|:.....:|   
 Frog   362 KSEA---IPESNDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDP 423

  Fly    96 ---CLDVDLAFGDLSTNFWLRG 114
               ...:|....|:.:.:.:||
 Frog   424 NIVIAKMDATANDVPSQYEVRG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 12/72 (17%)
pdia3NP_989329.1 ER_PDI_fam 23..483 CDD:273457 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.