DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and pdia2

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001307463.1 Gene:pdia2 / 394023 ZFINID:ZDB-GENE-040426-705 Length:555 Species:Danio rerio


Alignment Length:248 Identity:52/248 - (20%)
Similarity:93/248 - (37%) Gaps:58/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DVCPRSSRKSESSYLMAEYGDGLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLAST 92
            |..|....|::.   :.|..|.||  :...|:...|:....||: ..:.|.||.           
Zfish    40 DTEPEKPEKTDE---ITEDKDVLI--LHSVNFDRALSENKYLLV-EFYAPWCGH----------- 87

  Fly    93 SMGCLDVDLAFGDLSTNFWLRGRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELP 157
               |..::..:.:::..  |:...|..|.|.|..:   |.:.|:|....:|...|...:|.:...
Zfish    88 ---CRSLEPIYAEVAGQ--LKNASSEVRLAKVDAI---EEKELASEFSVDSFPTLKFFKEGNRQN 144

  Fly   158 PMPF-----------WLH----PTSTWST---SAEFVLKTAVDL-----KDLDILGRNAWK---- 195
            ...|           ||.    |::|...   |||.:|:....|     |||:  |..|..    
Zfish   145 ATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLE--GEKAKTFYDV 207

  Fly   196 TALILDLIFFIVTPYILWLTIMTTTENMMVNDEFKLGPTESSSPLPLKSISKI 248
            |.:.:|:.|.|.:...|:......|:::::..:|    .|..:.:||...:|:
Zfish   208 TLIAVDVNFGITSDPELFKKYEVKTDSLVLFKKF----DERRADMPLSDETKL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 18/96 (19%)
pdia2NP_001307463.1 ER_PDI_fam 56..512 CDD:273457 48/229 (21%)
PDI_a_family 65..161 CDD:239259 20/115 (17%)
PDI_b_family 169..268 CDD:239279 22/94 (23%)
PDI_b'_family 280..382 CDD:239280
PDI_a_PDI_a'_C 403..505 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.