DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Tmx1

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006240240.1 Gene:Tmx1 / 362751 RGDID:1308455 Length:298 Species:Rattus norvegicus


Alignment Length:230 Identity:52/230 - (22%)
Similarity:95/230 - (41%) Gaps:39/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RIDEGNWKEVLTGEWLLLICSSHQ------PSC----GDWKAVLYQLASTSMG-CLDVDLAFGDL 106
            |:.|..:|..|    |...|:.|:      |:|    .:|::.      ...| .|:|.:|..|:
  Rat    51 RLQEDTFKHFL----LHCKCNIHKSYAPWCPACQNLQPEWESF------AEWGEDLEVKVAKVDV 105

  Fly   107 STNFWLRGRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWST 171
            :....|.|||......::||..||||||..........:|.:..:||..:.|:..|..|:|...|
  Rat   106 TEQTGLSGRFIITALPSIYHCKDGEFRRYLGPRTKKDFINFISEKEWKNVEPVSSWFGPSSVLMT 170

  Fly   172 SAEFVLKTAVDLKD-----LDILGRNAWKTALILDLIFFIVTPYILWLTIMTTTENMMVNDEFKL 231
            :...:.:.:|.::.     :..||..||.:.|:. ....:::..:|.|.::...:        .|
  Rat   171 TMSALFQLSVYIRTSHSYFVHDLGIPAWGSYLVF-AFATVLSGLLLGLCMIFVAD--------CL 226

  Fly   232 GPTESSSPLPLKSISKIKSTTPIFLQKLRQLRESK 266
            .|::...|    .....|..:|.|.|.|:::.|.:
  Rat   227 CPSKRRRP----QQQPTKKPSPEFSQPLKKVEEEQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 28/105 (27%)
Tmx1XP_006240240.1 Thioredoxin_like <70..149 CDD:294274 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.