DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and pdia6

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_922915.2 Gene:pdia6 / 322160 ZFINID:ZDB-GENE-030131-879 Length:440 Species:Danio rerio


Alignment Length:225 Identity:51/225 - (22%)
Similarity:71/225 - (31%) Gaps:77/225 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RSSRKSESSYLMAEYGDGLITRIDEGNWKEV--LTGE------------WLLLICSSHQPSCG-- 80
            |...|:..|....:.|.|      .||.|:|  ||.:            ||:   ....|.||  
Zfish   138 RLGGKTGGSDYSRQSGGG------AGNKKDVVELTDDNFDRTVLESDDVWLV---EFFAPWCGHC 193

  Fly    81 -----DWKAVLYQLASTSMGCLDVDLAFGDLSTNFWLRGRFS--AFREANVYHVVDGEFRRLSSS 138
                 :|.|...::...:.|  .|.||..|.:.:..|..||.  .|....|       ||:....
Zfish   194 KNLEPEWTAAATEVKEQTKG--KVRLAAEDATVHQGLASRFGIRGFPTIKV-------FRKGEEP 249

  Fly   139 HD-----TNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVLKTAVDLKDLDILGRNAWKTAL 198
            .|     |.|.:....|..:|:..|.|           ..:.||...: ||          ||..
Zfish   250 EDYQGGRTRSDIVARALELYSDNIPAP-----------ELQEVLNEGI-LK----------KTCE 292

  Fly   199 ILDLIFFIVTPYIL---------WLTIMTT 219
            ...|....|.|:||         :|.:|.|
Zfish   293 DYQLCIIAVLPHILDTGASGRNSYLEVMKT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 28/124 (23%)
pdia6NP_922915.2 ER_PDI_fam 25..262 CDD:273457 33/141 (23%)
PDI_a_P5 26..128 CDD:239299
PDI_a_P5 161..266 CDD:239299 25/116 (22%)
P5_C 275..404 CDD:239281 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.