DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Dnajc10

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099956.2 Gene:Dnajc10 / 295690 RGDID:1307813 Length:793 Species:Rattus norvegicus


Alignment Length:207 Identity:42/207 - (20%)
Similarity:64/207 - (30%) Gaps:71/207 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WLLLICSSHQPSCGDWKAVLYQL--AST------SMGCLDVDLAFGDLST-NFWLRGRFSAFREA 122
            ||:   ....|.|...:|:|.:|  |||      .:|.||..:..|..:. |.........|.::
  Rat   471 WLV---DFFAPWCPPCRALLPELRKASTLLYGQLKVGTLDCTIHEGLCNMYNIQAYPTTVVFNQS 532

  Fly   123 NVYHVVDGEFRRLSSSHDTNSILNLLL-LREWS--ELPPMPF--------------------WLH 164
            :| |..:|.       |....||..:. ||..|  .|.|..|                    |.|
  Rat   533 SV-HEYEGH-------HSAEQILEFIEDLRNPSVVSLTPTTFNELVKQRKHDEVWMVDFYSPWCH 589

  Fly   165 PTST----WSTSAEFVLKTAVDLKDLDILGRNAWKTALILDLIFFIVTPYILWLTIMTTTENMMV 225
            |...    |...|. .|...:::..:|....:::                       .|.||:..
  Rat   590 PCQVLMPEWKRMAR-TLTGLINVGSVDCQQYHSF-----------------------CTQENVQR 630

  Fly   226 NDEFKLGPTESS 237
            ..|.:..|.:||
  Rat   631 YPEIRFYPQKSS 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 22/89 (25%)
Dnajc10NP_001099956.2 DnaJ 34..>132 CDD:223560
DnaJ 35..97 CDD:278647
PDI_a_ERdj5_N 129..229 CDD:239301
ER_PDI_fam 130..551 CDD:273457 22/90 (24%)
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302 22/89 (25%)
PDI_a_ERdj5_C 556..663 CDD:239302 18/111 (16%)
PDI_a_ERdj5_C 670..775 CDD:239302
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 790..793
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.