DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and P4hb

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_035162.1 Gene:P4hb / 18453 MGIID:97464 Length:509 Species:Mus musculus


Alignment Length:266 Identity:56/266 - (21%)
Similarity:94/266 - (35%) Gaps:92/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVL--YQLASTSMGCLDVDLAF--------GDLST 108
            :.:.|::|.|.....||: ..:.|.||..||:.  |..|:..:.....::..        .||:.
Mouse    31 LKKSNFEEALAAHKYLLV-EFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQ 94

  Fly   109 NFWLRG----------------RFSAFREAN----------------------VYHVVD------ 129
            .:.:||                .::|.|||:                      ...:||      
Mouse    95 QYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTV 159

  Fly   130 -GEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVL-KTAVDL-KDLDILGR 191
             |.|:.:.|    :|....||..|  .:..:||.:  ||.....:::.| |..|.| |..| .||
Mouse   160 IGFFKDVES----DSAKQFLLAAE--AIDDIPFGI--TSNSGVFSKYQLDKDGVVLFKKFD-EGR 215

  Fly   192 NAWKTAL----ILDLIFFIVTPYILWLTIMTTTENMMVNDEFKLGPTESSSPLPLKSISKIKSTT 252
            |.::..:    :||.|.....|.::               ||    ||.::|....  .:||:..
Mouse   216 NNFEGEITKEKLLDFIKHNQLPLVI---------------EF----TEQTAPKIFG--GEIKTHI 259

  Fly   253 PIFLQK 258
            .:||.|
Mouse   260 LLFLPK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 26/148 (18%)
P4hbNP_035162.1 ER_PDI_fam 26..476 CDD:273457 56/266 (21%)
Thioredoxin_like 31..135 CDD:294274 20/104 (19%)
PDI_b_family 139..234 CDD:239279 25/103 (24%)
PDI_b'_family 246..349 CDD:239280 6/22 (27%)
PDI_a_PDI_a'_C 370..472 CDD:239293
Prevents secretion from ER 506..509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.