Sequence 1: | NP_001261729.1 | Gene: | CG11588 / 39347 | FlyBaseID: | FBgn0036221 | Length: | 270 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035162.1 | Gene: | P4hb / 18453 | MGIID: | 97464 | Length: | 509 | Species: | Mus musculus |
Alignment Length: | 266 | Identity: | 56/266 - (21%) |
---|---|---|---|
Similarity: | 94/266 - (35%) | Gaps: | 92/266 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 IDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVL--YQLASTSMGCLDVDLAF--------GDLST 108
Fly 109 NFWLRG----------------RFSAFREAN----------------------VYHVVD------ 129
Fly 130 -GEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVL-KTAVDL-KDLDILGR 191
Fly 192 NAWKTAL----ILDLIFFIVTPYILWLTIMTTTENMMVNDEFKLGPTESSSPLPLKSISKIKSTT 252
Fly 253 PIFLQK 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11588 | NP_001261729.1 | Thioredoxin_like | 51..148 | CDD:294274 | 26/148 (18%) |
P4hb | NP_035162.1 | ER_PDI_fam | 26..476 | CDD:273457 | 56/266 (21%) |
Thioredoxin_like | 31..135 | CDD:294274 | 20/104 (19%) | ||
PDI_b_family | 139..234 | CDD:239279 | 25/103 (24%) | ||
PDI_b'_family | 246..349 | CDD:239280 | 6/22 (27%) | ||
PDI_a_PDI_a'_C | 370..472 | CDD:239293 | |||
Prevents secretion from ER | 506..509 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |