DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Y49E10.4

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:201 Identity:44/201 - (21%)
Similarity:69/201 - (34%) Gaps:79/201 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SYLMAEYGD-GLITRIDEGNWKEVLTGEWLLLICSSHQ-------PSCGDWKA--------VLYQ 88
            ||..::|.| |....:.||..|.|:.     .:|...|       ||..|.::        :|.:
 Worm   257 SYAESKYDDFGAAPEVVEGTGKAVVE-----TVCKDKQLCIFTFLPSIFDCQSKCRKQKIDMLNE 316

  Fly    89 LAS----TSMGCL--------DVDLAF--GD---------------LSTNFWLRGRFS--AFRE- 121
            ||:    .|.|.:        :|..||  ||               .||..   |:||  ..:| 
 Worm   317 LATIFKKRSFGWVWMEGGAQENVQRAFEIGDYGFPVLIAMSPKKMMYSTQI---GQFSVDGIKEF 378

  Fly   122 ANVYHVVDGEFRRLSSSHDTNSILNLLLLREW----SELPPMPFWLHPTSTWSTSAEFVLKTAVD 182
            .|..:...|....:..:|.:|:.|.::..:.|    .|||.|                   ..:|
 Worm   379 LNAVNYGKGRVLEIKPTHLSNNFLKIVETQPWDGKDKELPVM-------------------EDID 424

  Fly   183 LKDLDI 188
            |.|:|:
 Worm   425 LSDVDM 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 30/143 (21%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 1/1 (100%)
P5_C 269..405 CDD:239281 30/143 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.