DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and LOC1281559

DIOPT Version :10

Sequence 1:NP_648522.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_061503429.1 Gene:LOC1281559 / 1281559 VectorBaseID:AGAMI1_013610 Length:350 Species:Anopheles gambiae


Alignment Length:145 Identity:40/145 - (27%)
Similarity:70/145 - (48%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCLDVDLAFGDLSTNFWLRGR 115
            :..:||.||..:||.|||:...:...|:|.. .|.::...||....|::..|..|::::..|.||
Mosquito    30 VIELDESNWDRMLTDEWLVEFYAPWCPACKS-LAPIWDDLSTWSDDLNIKTAKVDVTSSPGLSGR 93

  Fly   116 FSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVLKTA 180
            |.......::||::||||:.....|.||.::.:..::|..|..:..|.:|.|...:......|.:
Mosquito    94 FFVTALPTIFHVINGEFRQYKGPRDMNSFMSFIEEKKWESLEQVSAWRNPDSIQMSLVSLFFKLS 158

  Fly   181 VDLKDLDILGRNAWK 195
            ..||    :.|..|:
Mosquito   159 HFLK----VSRTRWR 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_648522.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..148 CDD:469754 30/96 (31%)
LOC1281559XP_061503429.1 None

Return to query results.
Submit another query.