DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11588 and Pdia4

DIOPT Version :9

Sequence 1:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001355685.1 Gene:Pdia4 / 12304 MGIID:104864 Length:699 Species:Mus musculus


Alignment Length:294 Identity:61/294 - (20%)
Similarity:107/294 - (36%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LILLLSVFGVIPNAMIPKSPVNIDVCPRSSRKSESSYLMAEYGDGLITR-------IDEGNWKEV 62
            |:|||::..::  |.......:.|.....:...|......|..|.|..:       :::||:...
Mouse     9 LVLLLALTQLL--AAASAGDAHEDTSDTENATEEEEEEEEEDDDDLEVKEENGVWVLNDGNFDNF 71

  Fly    63 LTGEWLLLICSSHQPSCGDWK--AVLYQLASTSMGCLDVDLAFG--DLSTNFWLRGRFSAFREAN 123
            :..:..:|: ..:.|.||..|  |..|:..::::...|..:|..  |.::...|..:|.......
Mouse    72 VADKDTVLL-EFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPT 135

  Fly   124 VYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVLKTAVDLKDLDI 188
            :..:..|:......|.....|  :..:||.|:    |.|..|       .|..|....|  :.|.
Mouse   136 IKILKKGQAVDYDGSRTQEEI--VAKVREVSQ----PDWTPP-------PEVTLSLTKD--NFDD 185

  Fly   189 LGRNA----------WKTALILDLIFFIVTPYILWLTIMTTTENMMVNDEFK----------LGP 233
            :..||          |..||:|    |.::.|...:.:.|.|..:.||...|          :||
Mouse   186 VVNNADIILVEFYAPWTVALLL----FSLSFYQFAVLLSTHTGLLDVNANDKSLMFQQFSVPVGP 246

  Fly   234 TESSSPLPLKSISKI-----KSTTPIFLQKLRQL 262
            ..|.||   :..|||     |...|.:.:..::|
Mouse   247 VLSFSP---RRHSKIWCGHCKKLAPEYEKAAKEL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 17/107 (16%)
Pdia4NP_001355685.1 pdi_dom 63..164 CDD:273454 19/103 (18%)
ER_PDI_fam 173..691 CDD:273457 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.