DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5897 and CG4835

DIOPT Version :9

Sequence 1:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:350 Identity:66/350 - (18%)
Similarity:105/350 - (30%) Gaps:103/350 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GT--GYIGDPSDCQAWGYCQDNKLIDRRSCTEGLLYSFRDGTCKRASDTICHSQLS--------- 87
            ||  .|||   :|..:..|:||: :....|....|::.....|....|.:|....:         
  Fly   399 GTIFAYIG---NCSEYLICKDNQ-VQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPTTIP 459

  Fly    88 -----------------------EICASLEPWNYVANPADCRRFVKC-------------ADLDD 116
                                   ::|...|.....:.|.||.::..|             ....|
  Fly   460 TTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFD 524

  Fly   117 PTWGDCG---------VGQVFSNKKQTCLEEVAG--------------------CPQDNICSHMK 152
            |:.|.||         ..||.:....|..|....                    .|:..||....
  Fly   525 PSTGQCGPDVAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRN 589

  Fly   153 DGSFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNC-QSWMPHYCSKDDEDNILTP----P 212
            :...:..|.:|..|..|.:.......|..|.:|:.|...| ..|....|..|.....|.|    |
  Fly   590 ENENIAYPNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRP 654

  Fly   213 STDHNICSKYYQRDRDGVQLLPDLMTCYGYYSCTSQF----DVGKWSSCPWGLHFEWWSQRCGS- 272
            ..:..:|:   ...||... .||  .|..:..|...:    ||     |..|.:::..:::||: 
  Fly   655 PPEPTMCT---NSSRDTFP-YPD--NCQWFIRCVDDYIYMMDV-----CNCGEYYDPITEKCGAD 708

  Fly   273 -PKDNSCSYDRCANRNQLMVATINT 296
             |.| :|.:|..:..:.....|..|
  Fly   709 VPSD-ACRWDYTSTTSTTSEPTTTT 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 10/45 (22%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 13/48 (27%)
CBM_14 485..539 CDD:279884 11/53 (21%)
CBM_14 585..638 CDD:279884 11/52 (21%)
CBM_14 661..714 CDD:279884 15/64 (23%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.