DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sprn and CCDC181

DIOPT Version :9

Sequence 1:NP_001163425.2 Gene:Sprn / 39344 FlyBaseID:FBgn0036218 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001287898.1 Gene:CCDC181 / 57821 HGNCID:28051 Length:509 Species:Homo sapiens


Alignment Length:399 Identity:77/399 - (19%)
Similarity:149/399 - (37%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ISEFNKEEQTMEPYFIQELDMACAGQE-VEQVAEEN--VFE-----TGPQLKLPEN--------- 148
            |:|..|.:.::       ::|||..:| :.|..:||  |.|     :.|...|.:.         
Human    27 INENEKSDASI-------IEMACEKEENINQDLKENETVMEHTKRHSDPDKSLQDEVSPRRNDII 84

  Fly   149 --------QPINDSITTET-NETKLPSTEALNVLNLAEFSEPVMEKSNISIEEVNLTGAEEI--- 201
                    .||:||.:..: .|:||.|.:.|......|....:|||         :..|.::   
Human    85 SVPGIQPLDPISDSDSENSFQESKLESQKDLEEEEDEEVRRYIMEK---------IVQANKLLQN 140

  Fly   202 NEPISDEPNSQLVESAAKLQPKSLGIQIPPLQIEDLISPLVEQPKIATKLGVISFLTGNKLALTP 266
            .||::|:...:|     |.:.:.:.:::|||:.........|..:  ...|.:|.|         
Human   141 QEPVNDKRERKL-----KFKDQLVDLEVPPLEDTTTFKNYFENER--NMFGKLSQL--------- 189

  Fly   267 SVRLSFG--DRVTTRTN-----KKSKEIVQQQASK----ALKALISVFTMQRRLEASQCDN---- 316
            .:...||  |.:.:.||     .|.:.|:.::..|    .|:.:.|...:.....|:..:|    
Human   190 CISNDFGQEDVLLSLTNGSCEENKDRTILVERDGKFELLNLQDIASQGFLPPINNANSTENDPQQ 254

  Fly   317 ----SNNSRSKRFEQLKSSLTFSRVFRQNIFQPTSKI----------ESRQQNTDANSLESGEPN 367
                |:||.....::..|:.....|...:..:|.:.|          .|...|:| .|..:|:.|
Human   255 LLPRSSNSSVSGTKKEDSTAKIHAVTHSSTGEPLAYIAQPPLNRKTCPSSAVNSD-RSKGNGKSN 318

  Fly   368 FKSTSAYKEPLPIPY-----RQDAGEGLTCNGLNVSKDSVFSEVSESDVSETHN----KLFAMKK 423
            .::.||:..|:...|     :::..:.|......:.::....::.|....:..|    |.:..||
Human   319 HRTQSAHISPVTSTYCLSPRQKELQKQLEEKREKLKREEERRKIEEEKEKKRENDIVFKAWLQKK 383

  Fly   424 TQEGLSSTR 432
            .::.|...|
Human   384 REQVLEMRR 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SprnNP_001163425.2 PH-like 446..562 CDD:302622
CCDC181NP_001287898.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..120 17/73 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..367 21/126 (17%)
DUF4207 <338..461 CDD:290615 8/55 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.