DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sprn and Ccdc181

DIOPT Version :9

Sequence 1:NP_001163425.2 Gene:Sprn / 39344 FlyBaseID:FBgn0036218 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001014153.1 Gene:Ccdc181 / 360867 RGDID:1309708 Length:509 Species:Rattus norvegicus


Alignment Length:299 Identity:59/299 - (19%)
Similarity:113/299 - (37%) Gaps:88/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LDMACAGQ-EVEQVAEENVFET--GPQLKLPENQPINDSITTETNETKLPSTEALNVL------N 174
            :::||..: :::|..:|...||  ||||..|:..|.::::....:...:||.:.|:.:      |
  Rat    38 IEVACKKEDDLDQELKEKETETELGPQLSDPDKPPKDEALPRRNDFISVPSIQPLDPISDSDSEN 102

  Fly   175 LAEFSEPVMEK--SNISIEEVNLTGAEEI---------NEPISDEPNSQLVESAAKLQPKSLGIQ 228
            ..:.|:|..:|  .:...|||.....|:|         .||::|:...:|     |.:.|.:.::
  Rat   103 SFQDSKPENQKDLEDEEDEEVRRYIMEKIIEANKLLQTQEPVNDKRERKL-----KFKDKLVDLE 162

  Fly   229 IPPLQIEDLISPLVE-QPKIATKLGVISFLTGNKLALTPSVRLSFGDRVTTRTNKKSKEIVQQQA 292
            :|||:..|....|:| :..::.||..:..                           |.::.|:  
  Rat   163 VPPLEDSDTCKVLLENETNMSGKLSQLCI---------------------------SGDLGQE-- 198

  Fly   293 SKALKALISVFTMQRRLEASQCDNSNN----SRSKRFEQLKSSLTFSRVFRQNIFQP-------- 345
                ..|:||..       ..|:.::.    .|..:||    .:....:..|....|        
  Rat   199 ----SMLMSVTN-------GGCEENDRKILVERDGKFE----LMNLQDIESQGFLPPISSANGME 248

  Fly   346 --TSKIESRQQNTDANSLESGEPNFK----STSAYKEPL 378
              :|::..|..|.....::..||..|    :.|...|||
  Rat   249 HESSQLPLRSANLSVGGIKKEEPEAKIHIMTLSQAGEPL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SprnNP_001163425.2 PH-like 446..562 CDD:302622
Ccdc181NP_001014153.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..122 19/83 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..368 1/1 (100%)
DUF5401 <337..>494 CDD:375164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.