DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and Mpv17l

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_291042.2 Gene:Mpv17l / 93734 MGIID:2135951 Length:194 Species:Mus musculus


Alignment Length:168 Identity:44/168 - (26%)
Similarity:75/168 - (44%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISG 71
            ||....|..|         |...||:.:..||...||.::|   ||.|...||.:||.:      
Mouse     5 WRAFPQAARR---------YPWPTNVLLYAGLFSAGDALQQ---RLRGGPADWRQTRRV------ 51

  Fly    72 LTVGLVCH-----YWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEEL 131
            .|:.:..|     .|.:.|:...|.|..:.|:.|:|.||.:..|..::.|::.|::|:..  :::
Mouse    52 ATLAVTFHGNFNYVWLRLLERALPGRAPRTVLAKVLCDQTVGGPIALSAFYVGMSVLQGK--DDI 114

  Fly   132 EQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFY 169
            ..::::|....|.:....||..|..||.|:...:|..|
Mouse   115 FLDLKQKFWNTYKSGLMYWPFVQLTNFSLVPVHWRTAY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 11/48 (23%)
Mpv17lNP_291042.2 Targeting to peroxisomes 16..55 15/47 (32%)
Mpv17_PMP22 107..166 CDD:282035 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.