DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and SYM1

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_013352.1 Gene:SYM1 / 850953 SGDID:S000004241 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:41/159 - (25%)
Similarity:78/159 - (49%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNIGISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISG-LTVGLVCHYWYQHLD---YL-- 88
            ||..::..|..:||...|...........::..||.|..|.| |....:...||:.|:   |:  
Yeast    18 TNAIMTGALFGIGDVSAQLLFPTSKVNKGYDYKRTARAVIYGSLIFSFIGDKWYKILNNKIYMRN 82

  Fly    89 FPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLA 153
            .|:..:..:|:::.:||...:|..:..:|..|:|:|..:::..:.:|:|:........|.||||.
Yeast    83 RPQYHWSNMVLRVAVDQLAFAPLGLPFYFTCMSIMEGRSFDVAKLKIKEQWWPTLLTNWAVWPLF 147

  Fly   154 QFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            |.|||.::..|:|:...|.:::.::.|.|
Yeast   148 QAINFSVVPLQHRLLAVNVVAIFWNTYLS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 18/61 (30%)
SYM1NP_013352.1 Mpv17_PMP22 115..176 CDD:397992 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.