DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and MPV17L2

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_116072.2 Gene:MPV17L2 / 84769 HGNCID:28177 Length:206 Species:Homo sapiens


Alignment Length:191 Identity:77/191 - (40%)
Similarity:104/191 - (54%) Gaps:9/191 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELPD--WNRTRTIRMGI 69
            |||:...:.. .|:.|..:.||.||......|...||.:.||:|  |...|.  ::..|:..|..
Human     6 WRRLRRLLSA-GQLLFQGRALLVTNTLGCGALMAAGDGVRQSWE--IRARPGQVFDPRRSASMFA 67

  Fly    70 SGLTVGLVCHYWYQHLDYLFPK---RTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEEL 131
            .|.::|...||||..||.|||.   |.:..|:.|:|:||.:.||.....:||.:..||..|..|.
Human    68 VGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGES 132

  Fly   132 EQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPEP 192
            .||:|||....|.|:|.|||.|||:|||.:.||:||.|.|.::||:|.|.|.:||| .|.|
Human   133 CQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYR-SPVP 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 32/62 (52%)
MPV17L2NP_116072.2 Mpv17_PMP22 122..183 CDD:397992 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147003
Domainoid 1 1.000 69 1.000 Domainoid score I9646
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13093
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 1 1.000 - - FOG0003674
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11266
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2546
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.