DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and AT1G52870

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_564615.3 Gene:AT1G52870 / 841720 AraportID:AT1G52870 Length:366 Species:Arabidopsis thaliana


Alignment Length:137 Identity:42/137 - (30%)
Similarity:76/137 - (55%) Gaps:5/137 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VGDTMEQSYERLIGE-LPDWNRTRTIRMGISGLTV-GLVCHYWYQHLDYLFPKRTYKVVVVKILL 103
            |||.:.|.||   |: |.:.:|.||:|.|:.|.|: |.:.|::||..:.|||.:.:.||.||:..
plant   195 VGDWIAQCYE---GKPLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAF 256

  Fly   104 DQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVF 168
            ||.:.|..:.:::|..:..|...:...:.:|::...|.:..|.|.:||.|..|.:.|:..:.|:.
plant   257 DQTVWSAIWNSIYFTVLGFLRFESPISIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLL 321

  Fly   169 YDNTISL 175
            :.:.:.|
plant   322 WVDCVEL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 12/54 (22%)
AT1G52870NP_564615.3 Mpv17_PMP22 274..335 CDD:397992 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_115575
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.