DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and AT5G19750

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_197476.1 Gene:AT5G19750 / 832095 AraportID:AT5G19750 Length:288 Species:Arabidopsis thaliana


Alignment Length:149 Identity:43/149 - (28%)
Similarity:73/149 - (48%) Gaps:11/149 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGL-TVGLVCHYWYQHLDYLFPKRTYKVVVVKI 101
            |::|||.:.|   ..|.:....::.||:.....|| .||...|:||.:|..:.........|:::
plant   137 LNLVGDLICQ---LTINKTSSLDKKRTLTFTFLGLGLVGPTLHFWYLYLSKVVTASGLSGAVIRL 198

  Fly   102 LLDQFICSPFYIAVFFLTMAILE---DNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKP 163
            |||||:.:|.::.||...:..||   .|...:|:||.....:    |.|.:|...||:||..:..
plant   199 LLDQFVFAPIFVGVFLSAVVTLEGKPSNVIPKLQQEWTGAMI----ANWQLWIPFQFLNFRFVPQ 259

  Fly   164 QYRVFYDNTISLGYDIYTS 182
            .|:|...|.::|.:::..|
plant   260 NYQVLASNVVALAWNVILS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 18/64 (28%)
AT5G19750NP_197476.1 LbR-like <21..>69 CDD:248061
Mpv17_PMP22 220..278 CDD:367825 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.