DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and AT4G33905

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_567940.1 Gene:AT4G33905 / 829534 AraportID:AT4G33905 Length:261 Species:Arabidopsis thaliana


Alignment Length:164 Identity:43/164 - (26%)
Similarity:66/164 - (40%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ISVGLSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGLTV-GLVCHYWYQHLDYLFPKRTYKVV 97
            |.:...:...|:.|:      .:..::..||.|||..||.: |...|||:..:..|||||.....
plant   105 IYIAADLSSQTIPQA------SVDSYDLVRTARMGGYGLLILGPTLHYWFNLMSSLFPKRDLITT 163

  Fly    98 VVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKAL------VLYAAEWTVWPLAQFI 156
            ..|:.:.|.:..|....|||...|.|:.....|:...::...|      |:|      |||..||
plant   164 FKKMAMGQTVYGPAMNVVFFSLNAALQGENGSEIVARLKRDLLPTMLNGVMY------WPLCDFI 222

  Fly   157 NFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKP 190
            .|.......:....|:.|..:.||.:.:..|..|
plant   223 TFKFCPVYLQPLVSNSFSYLWTIYITYMASRATP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 15/68 (22%)
AT4G33905NP_567940.1 Mpv17_PMP22 187..247 CDD:397992 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.