DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and PMP22

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001319865.1 Gene:PMP22 / 825777 AraportID:AT4G04470 Length:190 Species:Arabidopsis thaliana


Alignment Length:150 Identity:35/150 - (23%)
Similarity:73/150 - (48%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ISVG-LSMVGDTMEQSYERLIGELPDWNRTRTIRMGISGLTVGLVCHYWYQHLDYLFP-KRTYKV 96
            |:.| ||.|.|.:.|   :|.|......|...:::..:|..:|...|:::.:||..|. |:..:.
plant    28 ITAGVLSGVSDVVSQ---KLSGIQKIQLRRVLLKVIFAGGFLGPAGHFFHTYLDKFFKGKKDTQT 89

  Fly    97 VVVKILLDQFICSPFYIAVFFLTMAILEDNT-WEELEQEIREKALVLYAAEWTVWPLAQFINFLL 160
            |..|::|:|...||....:|.:...::.:.| |..:.:.|::....:....||.:|:..:||:..
plant    90 VAKKVILEQLTLSPLNHLLFMIYYGVVIERTPWTLVRERIKKTYPTVQLTAWTFFPVVGWINYKY 154

  Fly   161 IKPQYRVFYDNTISLGYDIY 180
            :...:||...:.::..:.|:
plant   155 VPLHFRVILHSLVAFFWGIF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 11/59 (19%)
PMP22NP_001319865.1 Mpv17_PMP22 116..175 CDD:397992 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.