DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and AT2G42770

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_565983.1 Gene:AT2G42770 / 818877 AraportID:AT2G42770 Length:232 Species:Arabidopsis thaliana


Alignment Length:170 Identity:52/170 - (30%)
Similarity:74/170 - (43%) Gaps:32/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LSMVGDTMEQ--------------SYERLIGEL------PDWNRTRTIRMGISG-LTVGLVCHYW 81
            |:..|||:.|              |.|...|||      .||  .|.:||...| |..|...:.|
plant    65 LTFTGDTIAQLSGRWKKRTALKQSSSELDEGELWNIFSEHDW--IRALRMSSYGFLLYGPGSYAW 127

  Fly    82 YQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTW----EELEQEIREKALVL 142
            ||.||:..||.|...:|:|:||:|.|..|..|||.|..     :|.|    .||..:.::.||..
plant   128 YQFLDHSLPKPTATNLVLKVLLNQVILGPSVIAVIFAW-----NNLWLGKLSELGNKYQKDALPT 187

  Fly   143 YAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            ....:..|.....:||.::..|.||.:.:..|:.::.|.|
plant   188 LLYGFRFWVPVSILNFWVVPLQARVAFMSMGSVFWNFYLS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 15/65 (23%)
AT2G42770NP_565983.1 Mpv17_PMP22 173..227 CDD:397992 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.