DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and AT2G14860

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_179092.1 Gene:AT2G14860 / 815975 AraportID:AT2G14860 Length:252 Species:Arabidopsis thaliana


Alignment Length:168 Identity:47/168 - (27%)
Similarity:69/168 - (41%) Gaps:25/168 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IGISVGLS--MVGDTMEQSYERLIGELPDWNRTRTIRMGISGLTV-GLVCHYWYQHLDYLFPKRT 93
            |.|:..||  .:..|..:||:.:          ||.|||..||.| |...|||:..:..||||:.
plant    96 IYIAADLSSQTIAKTSSESYDLV----------RTARMGGYGLFVLGPTLHYWFNFMSRLFPKQD 150

  Fly    94 YKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKAL------VLYAAEWTVWPL 152
            ......|:.:.|.|..|....:||...|.|:......:...::...|      |:|      |||
plant   151 LITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVMY------WPL 209

  Fly   153 AQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKP 190
            ..||.|.......:....|:.|..:.||.:.:..|:||
plant   210 CDFITFRFFPVHLQPLVSNSFSYVWTIYMTYMANREKP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 14/68 (21%)
AT2G14860NP_179092.1 Mpv17_PMP22 180..243 CDD:282035 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4140
eggNOG 1 0.900 - - E1_KOG1944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1324608at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.