DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and si:ch211-120k19.1

DIOPT Version :9

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001313499.1 Gene:si:ch211-120k19.1 / 563199 ZFINID:ZDB-GENE-100922-282 Length:231 Species:Danio rerio


Alignment Length:136 Identity:39/136 - (28%)
Similarity:66/136 - (48%) Gaps:13/136 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DWNRTRTIRMGISGLTVGLVCH-----YWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFF 117
            ||::|..:.:      ||...|     ||.:.|:.:||....|.|.:|::|||.|.:|..|:.|:
Zfish    99 DWSQTARVAL------VGFCFHANFNYYWLRGLERMFPGGGTKRVSLKVILDQLIAAPMTISAFY 157

  Fly   118 LTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDIYTS 182
            :.::.||..  |:..::.:.|....|......|...|.:||.||.|..|..:...::||:.|:..
Zfish   158 IGLSTLEGA--EDPFEDWKNKFWTSYKTGVVYWSTMQAVNFSLIPPAARTVFVGGVALGWTIFLC 220

  Fly   183 QVKYRK 188
            ..|.:|
Zfish   221 HFKQQK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 122..185 CDD:282035 16/62 (26%)
si:ch211-120k19.1NP_001313499.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.