DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5906 and mpv17l

DIOPT Version :10

Sequence 1:NP_648518.1 Gene:CG5906 / 39343 FlyBaseID:FBgn0036217 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_691639.1 Gene:mpv17l / 563178 ZFINID:ZDB-GENE-120215-229 Length:199 Species:Danio rerio


Alignment Length:109 Identity:37/109 - (33%)
Similarity:58/109 - (53%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DWNRTRTIRMGISGLTV-GLVCHYWYQHLDYLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMA 121
            ||..||.:  .|..|:. |...::|.:.|:..||.|:..:|..|::|||...||...:||:..::
Zfish    45 DWRHTRNV--AIVALSFQGNFNYFWLRALESRFPGRSAGMVFRKLVLDQSFASPLATSVFYTGVS 107

  Fly   122 ILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQY 165
            .||..  |::.::.|||....|......||..||:||:|: |.|
Zfish   108 FLEGK--EDIFEDWREKFFNTYKTGLMYWPFMQFLNFVLM-PLY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5906NP_648518.1 Mpv17_PMP22 121..182 CDD:461182 16/45 (36%)
mpv17lXP_691639.1 Mpv17_PMP22 107..166 CDD:461182 16/45 (36%)

Return to query results.
Submit another query.